PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D05G3714
Common NameMYB80-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 336aa    MW: 37496.1 Da    PI: 7.9782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D05G3714genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.11e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I++  g+ R++k+c++rw +yl
      Gh_D05G3714 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding44.73.2e-1468110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E++ +v+++   G++ W++Ia+ ++ gRt++++k++w++
      Gh_D05G3714  68 GQFSNAEEQTIVKLHSVVGNR-WSLIAAQLP-GRTDNDVKNHWNT 110
                      78999****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.617965IPR017930Myb domain
SuperFamilySSF466894.12E-2911108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002493.3E-171461IPR001005SANT/Myb domain
CDDcd001673.69E-121761No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2465116IPR009057Homeodomain-like
SMARTSM007176.0E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129420.45366116IPR017930Myb domain
PfamPF002491.1E-1268110IPR001005SANT/Myb domain
CDDcd001671.71E-970112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SNAEEQTIVK LHSVVGNRWS LIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL APPQVAHLAE AALGCFKDEM LHLLTKKRID FQLQQSNPGQ  180
GNNTTVPYSK QDEKDDTVEK IKLNLSRAIQ EPDMLPLNKP WESTSTRATS ANFEGGCGVF  240
PTSVTGYHHY GPSSFANEGG GSGSPWSQSM CTGSTCTAGE QVRSHEKLKD ENGEEFQGGK  300
EIKNATSIFN TDCVLWDIPS DDLINPIYRE AFNNKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-27141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6757060.0KM675706.1 Gossypium hirsutum MYB80-1 (MYB80-1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444117.10.0PREDICTED: myb-related protein 308
SwissprotQ7XQN11e-124MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A097IWS70.0A0A097IWS7_G
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM100052635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-119myb domain protein 103
Publications ? help Back to Top
  1. Xu Y,Iacuone S,Li SF,Parish RW
    MYB80 homologues in Arabidopsis, cotton and Brassica: regulation and functional conservation in tapetal and pollen development.
    BMC Plant Biol., 2014. 14: p. 278
    [PMID:25311582]